Lineage for d1a6wh_ (1a6w H:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 362617Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins)
  6. 362751Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 363037Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (141 PDB entries)
  8. 363047Domain d1a6wh_: 1a6w H: [20253]
    Other proteins in same PDB: d1a6wl_
    part of Fv B1-8; this domain is identical to the N-terminal domain of scFv 1NQB
    complexed with nip

Details for d1a6wh_

PDB Entry: 1a6w (more details), 1.8 Å

PDB Description: b1-8 fv fragment complexed with a (4-hydroxy-5-iodo-3-nitrophenyl) acetate compound

SCOP Domain Sequences for d1a6wh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a6wh_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2}
qvqlqqpgaelvkpgasvklsckasgytftsywmhwvkqrpgrglewigridpnsggtky
nekfkskatltvdkpsstaymqlssltsedsavyycarydyygssyfdywgqgttvtvss

SCOP Domain Coordinates for d1a6wh_:

Click to download the PDB-style file with coordinates for d1a6wh_.
(The format of our PDB-style files is described here.)

Timeline for d1a6wh_: