SCOPe 2.03: Domain d4i1ua_: 4i1u A:

Lineage for d4i1ua_ (4i1u A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (58 species)
   not a true protein

7. Species Burkholderia vietnamiensis [TaxId:269482] [194164] (2 PDB entries)

8. Domain d4i1ua_: 4i1u A: [202524]
   automated match to d4i1ub_
   complexed with cl, edo, so4

Details for d4i1ua_

PDB Entry: 4i1u, 2.05 Å

PDB Description: Apo crystal structure of a dephospho-CoA kinase from Burkholderia vietnamiensis

PDB Compounds: (A:) dephospho-coa kinase

SCOPe Domain Sequences for d4i1ua_:

Sequence; same for both SEQRES and ATOM records:

>d4i1ua_ c.37.1.0 (A:) automated matches {Burkholderia vietnamiensis [TaxId: 269482]}
hhhmyaigltggigsgkttvadlfaargaslvdtdliahritapaglampaieqtfgpaf
vaadgsldrarmralifsdedarrrleaithpliraetereardaqgpyvifvvpllves
rnwkarcdrvlvvdcpvdtqiarvmqrngftreqveaiiarqatrearlaaaddvivnda
atpdalavqvdalhqrylafaaakh

Timeline for d4i1ua_:

• d4i1ua_ is new in SCOPe 2.03-stable
  
• d4i1ua_ appears in SCOPe 2.04
  
• d4i1ua_ appears in the current release, SCOPe 2.08, called d4i1ua1