Class b: All beta proteins [48724] (104 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species) |
Species Fv B1-8 (mouse), lambda L chain [48853] (3 PDB entries) |
Domain d1a6wl_: 1a6w L: [20252] |
PDB Entry: 1a6w (more details), 1.8 Å
SCOP Domain Sequences for d1a6wl_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a6wl_ b.1.1.1 (L:) Immunoglobulin (variable domains of L and H chains) {Fv B1-8 (mouse), lambda L chain} avvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgvp arfsgslignkaaltitgaqtedeaiyfcalwysnhwvfgggtkltvle
Timeline for d1a6wl_: