Lineage for d1a6wl_ (1a6w L:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 51642Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 51698Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)
  7. 52587Species Fv B1-8 (mouse), lambda L chain [48853] (3 PDB entries)
  8. 52589Domain d1a6wl_: 1a6w L: [20252]

Details for d1a6wl_

PDB Entry: 1a6w (more details), 1.8 Å

PDB Description: b1-8 fv fragment complexed with a (4-hydroxy-5-iodo-3-nitrophenyl) acetate compound

SCOP Domain Sequences for d1a6wl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a6wl_ b.1.1.1 (L:) Immunoglobulin (variable domains of L and H chains) {Fv B1-8 (mouse), lambda L chain}
avvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgvp
arfsgslignkaaltitgaqtedeaiyfcalwysnhwvfgggtkltvle

SCOP Domain Coordinates for d1a6wl_:

Click to download the PDB-style file with coordinates for d1a6wl_.
(The format of our PDB-style files is described here.)

Timeline for d1a6wl_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1a6wh_