Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (18 proteins) core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest |
Protein automated matches [190393] (10 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [196788] (1 PDB entry) |
Domain d4hyyb_: 4hyy B: [202517] automated match to d4hyya_ |
PDB Entry: 4hyy (more details), 2.6 Å
SCOPe Domain Sequences for d4hyyb_:
Sequence, based on SEQRES records: (download)
>d4hyyb_ c.37.1.11 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} gfltafeysekrkmvfhittgsqefdkllgggiesmaiteafgefrtgktqlshtlcvta qlpgaggypggkiifidtentfrpdrlrdiadrfnvdhdavldnvlyaraytsehqmell dyvaakfheeagifklliidsimalfrvdfsgrgelaerqqklaqmlsrlqkiseeynva vfvtnqmtadpgatmtfqadpkkpigghilahasttrislrkgrgelriakiydspempe neatfaitaggigda
>d4hyyb_ c.37.1.11 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} gfltafeysekrkmvfhittgsqefdkllgggiesmaiteafgefrtgktqlshtlcvta qlpgaggypggkiifidtentfrpdrlrdiadrfnvdhdavldnvlyaraytsehqmell dyvaakfheeagifklliidsimalfrvdfsgrgelaerqqklaqmlsrlqkiseeynva vfvtnqmtkpigghilahasttrislrkgrgelriakiydspempeneatfaitaggigd a
Timeline for d4hyyb_: