SCOPe 2.01: Domain d1a6td1: 1a6t D:1-113

Lineage for d1a6td1 (1a6t D:1-113)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (152 PDB entries)
   Uniprot P01756 1-117 # 78% sequense identity; HV12_MOUSE Ig heavy chain V region MOPC 104E ! SQ NA # humanized antibody ! Uniprot P01750 # HV06_MOUSE Ig heavy chain V region 102 precursor ! Uniprot P01750 20-116 # ! HV06_MOUSE Ig heavy chain V region 102 precursor

8. Domain d1a6td1: 1a6t D:1-113 [20251]
   Other proteins in same PDB: d1a6ta1, d1a6ta2, d1a6tb2, d1a6tc1, d1a6tc2, d1a6td2
   part of human rhinovirus 14 neutralizing Fab Mab1-IA

Details for d1a6td1

PDB Entry: 1a6t, 2.7 Å

PDB Description: fab fragment of mab1-ia monoclonal antibody to human rhinovirus 14 nim-ia site

PDB Compounds: (D:) igg1 fab1-ia fab (heavy chain)

SCOPe Domain Sequences for d1a6td1:

Sequence; same for both SEQRES and ATOM records:

>d1a6td1 b.1.1.1 (D:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
evqlqqsgpdlvkpgasvkisckasgysfstyymhwvkqshgkslewigrvdpdnggtsf
nqkfkgkailtvdkssstaymelgsltsedsavyycarrddyyfdfwgqgtsltvss

Timeline for d1a6td1:

• d1a6td1 first appeared (with stable ids) in SCOP 1.55
  
• d1a6td1 appears in SCOP 1.75
  
• d1a6td1 appears in SCOPe 2.02
  
• d1a6td1 appears in the current release, SCOPe 2.08