Lineage for d1a6td1 (1a6t D:1-113)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 218899Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)
  6. 218958Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)
  7. 219850Species Fab Mab1-IA (mouse), kappa L chain [48852] (1 PDB entry)
    neutralizes human rhinovirus 14
  8. 219854Domain d1a6td1: 1a6t D:1-113 [20251]
    Other proteins in same PDB: d1a6ta2, d1a6tb2, d1a6tc2, d1a6td2

Details for d1a6td1

PDB Entry: 1a6t (more details), 2.7 Å

PDB Description: fab fragment of mab1-ia monoclonal antibody to human rhinovirus 14 nim-ia site

SCOP Domain Sequences for d1a6td1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a6td1 b.1.1.1 (D:1-113) Immunoglobulin (variable domains of L and H chains) {Fab Mab1-IA (mouse), kappa L chain}
evqlqqsgpdlvkpgasvkisckasgysfstyymhwvkqshgkslewigrvdpdnggtsf
nqkfkgkailtvdkssstaymelgsltsedsavyycarrddyyfdfwgqgtsltvss

SCOP Domain Coordinates for d1a6td1:

Click to download the PDB-style file with coordinates for d1a6td1.
(The format of our PDB-style files is described here.)

Timeline for d1a6td1: