Lineage for d1a6tc1 (1a6t C:1-107)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1755448Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1756616Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1757200Species Mouse (Mus musculus), cluster 3.3 [TaxId:10090] [88529] (2 PDB entries)
  8. 1757203Domain d1a6tc1: 1a6t C:1-107 [20250]
    Other proteins in same PDB: d1a6ta2, d1a6tb1, d1a6tb2, d1a6tc2, d1a6td1, d1a6td2
    part of human rhinovirus 14 neutralizing Fab Mab1-IA

Details for d1a6tc1

PDB Entry: 1a6t (more details), 2.7 Å

PDB Description: fab fragment of mab1-ia monoclonal antibody to human rhinovirus 14 nim-ia site
PDB Compounds: (C:) igg1 fab1-ia fab (light chain)

SCOPe Domain Sequences for d1a6tc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a6tc1 b.1.1.1 (C:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 3.3 [TaxId: 10090]}
qsvlsqspailsaspgekvimtcspsssvsymqwyqqkpgsspkpwiystsnlasgvpgr
fsgggsgtsfsltisgveaedaatyycqqysshpltfgggtklelk

SCOPe Domain Coordinates for d1a6tc1:

Click to download the PDB-style file with coordinates for d1a6tc1.
(The format of our PDB-style files is described here.)

Timeline for d1a6tc1: