SCOPe 2.03: Domain d4huxa2: 4hux A:182-276

Lineage for d4huxa2 (4hux A:182-276)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class I MHC, alpha-3 domain [88604] (4 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88606] (101 PDB entries)
   Uniprot P01901 22-299

8. Domain d4huxa2: 4hux A:182-276 [202486]
   Other proteins in same PDB: d4huxa1, d4huxb_
   automated match to d1kjva1
   complexed with act, gol

Details for d4huxa2

PDB Entry: 4hux, 2.2 Å

PDB Description: crystal structure of h2db-h155a-np

PDB Compounds: (A:) H-2 class I histocompatibility antigen, D-B alpha chain

SCOPe Domain Sequences for d4huxa2:

Sequence, based on SEQRES records:

>d4huxa2 b.1.1.2 (A:182-276) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf
qkwasvvvplgkeqnytcrvyheglpepltlrwep

Sequence, based on observed residues (ATOM records):

>d4huxa2 b.1.1.2 (A:182-276) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf
qkwasvvvplqnytcrvyheglpepltlrwep

Timeline for d4huxa2:

• d4huxa2 is new in SCOPe 2.03-stable
  
• d4huxa2 appears in SCOPe 2.04
  
• d4huxa2 appears in the current release, SCOPe 2.08