SCOPe 2.05: Domain d4hu1b_: 4hu1 B:

Lineage for d4hu1b_ (4hu1 B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
   single sheet; 10 strands

4. Superfamily b.74.1: Carbonic anhydrase [51069] (2 families)

5. Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins)
   automatically mapped to Pfam PF00194

6. Protein automated matches [190681] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187805] (18 PDB entries)

8. Domain d4hu1b_: 4hu1 B: [202473]
   automated match to d4hu1a_
   complexed with edo, peg, v13, zn

Details for d4hu1b_

PDB Entry: 4hu1, 1.95 Å

PDB Description: Crystal structure of human carbonic anhydrase isozyme XIII with the inhibitor.

PDB Compounds: (B:) Carbonic anhydrase 13

SCOPe Domain Sequences for d4hu1b_:

Sequence; same for both SEQRES and ATOM records:

>d4hu1b_ b.74.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rlswgyrehngpihwkeffpiadgdqqspieiktkevkydsslrplsikydpssakiisn
sghsfnvdfddtenksvlrggpltgsyrlrqvhlhwgsaddhgsehivdgvsyaaelhvv
hwnsdkypsfveaahepdglavlgvflqigepnsqlqkitdtldsikekgkqtrftnfdl
lsllppswdywtypgsltvppllesvtwivlkqpinissqqlakfrsllctaegeaaafl
vsnhrppqplkgrkvrasfh

Timeline for d4hu1b_:

• d4hu1b_ first appeared in SCOPe 2.03
  
• d4hu1b_ appears in SCOPe 2.04
  
• d4hu1b_ appears in SCOPe 2.06
  
• d4hu1b_ appears in the current release, SCOPe 2.08