Lineage for d1dsfh_ (1dsf H:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 51642Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 51698Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)
  7. 51849Species Anticancer Fv B1 (mouse) [48851] (1 PDB entry)
  8. 51850Domain d1dsfh_: 1dsf H: [20247]

Details for d1dsfh_

PDB Entry: 1dsf (more details), 2.2 Å

PDB Description: the crystal structure of the disulfide-stabilized fv fragment of anticancer antibody b1: conformational influence of an engineered disulfide bond

SCOP Domain Sequences for d1dsfh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dsfh_ b.1.1.1 (H:) Immunoglobulin (variable domains of L and H chains) {Anticancer Fv B1 (mouse)}
qlvesggglvkpggslklscaasgfifsdnymywvrqtpekclewvatisdggtyidysd
svkgrftisrdnaknnlylqmsslrsedtgmyycgrspiyydyapftywgqgtlvtvsa

SCOP Domain Coordinates for d1dsfh_:

Click to download the PDB-style file with coordinates for d1dsfh_.
(The format of our PDB-style files is described here.)

Timeline for d1dsfh_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1dsfl_