Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) |
Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
Protein automated matches [190118] (16 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189560] (113 PDB entries) |
Domain d4hk2b1: 4hk2 B:1-72 [202443] Other proteins in same PDB: d4hk2a2, d4hk2b2, d4hk2c2, d4hk2d2 automated match to d4hk2c_ complexed with so4 |
PDB Entry: 4hk2 (more details), 1.4 Å
SCOPe Domain Sequences for d4hk2b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hk2b1 d.15.1.1 (B:1-72) automated matches {Human (Homo sapiens) [TaxId: 9606]} mqifvkfrtgktytlevepsdtienvkakiqdklgippdqqwlifagkrledgrtlsdyn iqkestlrgvrr
Timeline for d4hk2b1: