SCOPe 2.08: Domain d4hk2b1: 4hk2 B:1-72

Lineage for d4hk2b1 (4hk2 B:1-72)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
   Pfam PF00240

6. Protein automated matches [190118] (16 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189560] (113 PDB entries)

8. Domain d4hk2b1: 4hk2 B:1-72 [202443]
   Other proteins in same PDB: d4hk2a2, d4hk2b2, d4hk2c2, d4hk2d2
   automated match to d4hk2c_
   complexed with so4

Details for d4hk2b1

PDB Entry: 4hk2, 1.4 Å

PDB Description: U7Ub25.2540

PDB Compounds: (B:) Ubiquitin

SCOPe Domain Sequences for d4hk2b1:

Sequence; same for both SEQRES and ATOM records:

>d4hk2b1 d.15.1.1 (B:1-72) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mqifvkfrtgktytlevepsdtienvkakiqdklgippdqqwlifagkrledgrtlsdyn
iqkestlrgvrr

Timeline for d4hk2b1:

• d4hk2b1 first appeared in SCOPe 2.03, called d4hk2b_
  
• d4hk2b1 appears in SCOPe 2.07