Lineage for d1ay1h1 (1ay1 H:1-115)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 546420Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)
  6. 546556Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 547188Species Mouse (Mus musculus), cluster 7.1 [TaxId:10090] [88557] (34 PDB entries)
  8. 547199Domain d1ay1h1: 1ay1 H:1-115 [20243]
    Other proteins in same PDB: d1ay1h2, d1ay1l1, d1ay1l2
    part of Fab TP7 against Taq DNA polymerase

Details for d1ay1h1

PDB Entry: 1ay1 (more details), 2.2 Å

PDB Description: anti taq fab tp7

SCOP Domain Sequences for d1ay1h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ay1h1 b.1.1.1 (H:1-115) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.1}
evqlqesgpglvkpyqslslsctvtgysitsdyawnwirqfpgnklewmgyitysgttdy
npslksrisitrdtsknqfflqlnsvttedtatyycaryyygywyfdvwgqgttltvss

SCOP Domain Coordinates for d1ay1h1:

Click to download the PDB-style file with coordinates for d1ay1h1.
(The format of our PDB-style files is described here.)

Timeline for d1ay1h1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ay1h2