Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) C-terminal domain is beta/alpha barrel |
Family d.58.9.0: automated matches [227234] (1 protein) not a true family |
Protein automated matches [226983] (27 species) not a true protein |
Species Pea (Pisum sativum) [TaxId:3888] [226513] (2 PDB entries) |
Domain d4hhhb1: 4hhh B:12-149 [202425] Other proteins in same PDB: d4hhha2, d4hhhb2, d4hhhc2, d4hhhd2, d4hhhs_, d4hhht_, d4hhhu_, d4hhhv_ automated match to d1gk8a2 complexed with rub |
PDB Entry: 4hhh (more details), 2.2 Å
SCOPe Domain Sequences for d4hhhb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hhhb1 d.58.9.0 (B:12-149) automated matches {Pea (Pisum sativum) [TaxId: 3888]} gfkagvkdykltyytpdyqtkdtdilaafrvtpqpgvppeeagaavaaesstgtwttvwt dgltsldrykgrcyeiepvpgednqfiayvaypldlfeegsvtnmftsivgnvfgfkalr alrledlripyayvktfq
Timeline for d4hhhb1: