Lineage for d1ay1l1 (1ay1 L:1-107)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 51642Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 51698Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)
  7. 52553Species Fab TP7 (mouse), kappa L chain [48850] (2 PDB entries)
  8. 52555Domain d1ay1l1: 1ay1 L:1-107 [20242]
    Other proteins in same PDB: d1ay1h2, d1ay1l2

Details for d1ay1l1

PDB Entry: 1ay1 (more details), 2.2 Å

PDB Description: anti taq fab tp7

SCOP Domain Sequences for d1ay1l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ay1l1 b.1.1.1 (L:1-107) Immunoglobulin (variable domains of L and H chains) {Fab TP7 (mouse), kappa L chain}
diqmtqspaimsaspgekvtmtcsasssvsymywyqqkpgssprlliydstnlasgvpvr
fsgsgsgtsysltisrmeaedaatyycqqwstypltfgagtklelk

SCOP Domain Coordinates for d1ay1l1:

Click to download the PDB-style file with coordinates for d1ay1l1.
(The format of our PDB-style files is described here.)

Timeline for d1ay1l1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ay1l2