SCOP 1.63: Domain d1a3lh1: 1a3l H:1-113

Lineage for d1a3lh1 (1a3l H:1-113)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)

7. Species Diels-Alder catalytic Fab 13G5 (mouse), kappa L chain [48849] (1 PDB entry)

8. Domain d1a3lh1: 1a3l H:1-113 [20241]
   Other proteins in same PDB: d1a3lh2, d1a3ll2
   complexed with cfc

Details for d1a3lh1

PDB Entry: 1a3l, 1.95 Å

PDB Description: catalysis of a disfavored reaction: an antibody exo diels-alderase-tsa-inhibitor complex at 1.95 a resolution

SCOP Domain Sequences for d1a3lh1:

Sequence; same for both SEQRES and ATOM records:

>d1a3lh1 b.1.1.1 (H:1-113) Immunoglobulin (variable domains of L and H chains) {Diels-Alder catalytic Fab 13G5 (mouse), kappa L chain}
evqleesgpelvrpgtsvkisckasgytftnywlgwvkqrpghgfewigdiypggvyttn
nekfrgkailtadtssstaymqlssltsedsavyfcaraggyytggdywgqgtsvtvss

Timeline for d1a3lh1:

• d1a3lh1 first appeared (with stable ids) in SCOP 1.55
  
• d1a3lh1 appears in SCOP 1.61
  
• d1a3lh1 appears in SCOP 1.65
  
• d1a3lh1 appears in the current release, SCOPe 2.08