SCOPe 2.05: Domain d4h99h2: 4h99 H:36-250

Lineage for d4h99h2 (4h99 H:36-250)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.41: PRC-barrel domain [50345] (1 superfamily)
   core: barrel, partly opened; n*=5, S*=8; meander

4. Superfamily b.41.1: PRC-barrel domain [50346] (5 families)

5. Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (2 proteins)

6. Protein Photosynthetic reaction centre [50348] (3 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [50350] (83 PDB entries)
   Uniprot P11846

8. Domain d4h99h2: 4h99 H:36-250 [202390]
   Other proteins in same PDB: d4h99h1, d4h99l_, d4h99m_
   automated match to d1qovh1
   complexed with bcl, bph, fe, spo, u10

Details for d4h99h2

PDB Entry: 4h99, 2.97 Å

PDB Description: bacterial photosynthetic reaction center from rhodobacter sphaeroides with ile m265 replaced with thr

PDB Compounds: (H:) reaction center protein h chain

SCOPe Domain Sequences for d4h99h2:

Sequence; same for both SEQRES and ATOM records:

>d4h99h2 b.41.1.1 (H:36-250) Photosynthetic reaction centre {Rhodobacter sphaeroides [TaxId: 1063]}
mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg
fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg
cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag
iptiksptevtlleedkicgyvagglmyaapkrks

Timeline for d4h99h2:

• d4h99h2 first appeared in SCOPe 2.03
  
• d4h99h2 appears in SCOPe 2.04
  
• d4h99h2 appears in SCOPe 2.06
  
• d4h99h2 appears in the current release, SCOPe 2.08