SCOPe 2.08: Domain d4h7ma1: 4h7m A:7-225

Lineage for d4h7ma1 (4h7m A:7-225)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)

6. Protein automated matches [190135] (18 species)
   not a true protein

7. Species Trichoderma harzianum [TaxId:5544] [196740] (1 PDB entry)

8. Domain d4h7ma1: 4h7m A:7-225 [202385]
   Other proteins in same PDB: d4h7ma2, d4h7ma3, d4h7mb2
   automated match to d4h7mb_

Details for d4h7ma1

PDB Entry: 4h7m, 2.07 Å

PDB Description: The X-ray Crystal Structure of the Trichoderma harzianum Endoglucanase 3 from family GH12

PDB Compounds: (A:) endo-1,4-beta-glucanase

SCOPe Domain Sequences for d4h7ma1:

Sequence; same for both SEQRES and ATOM records:

>d4h7ma1 b.29.1.11 (A:7-225) automated matches {Trichoderma harzianum [TaxId: 5544]}
qtsceqyavfsggngysvsnnlwgqsagsgfgcitvnslnsaaswhadwqwsggqnnvks
ypnvqiaipqkrivnsigsmpttaswsytgsnlradvaydlftasnpnhvtysgdyelmi
wlarygdigpigsaqgtvtingqswtlyygfngamqvysfvapstvtnwsgdvknffnyl
rdnkgypassqyvlsyqfgtepftgsgtlnvnswtasin

Timeline for d4h7ma1:

• d4h7ma1 first appeared in SCOPe 2.03, called d4h7ma_
  
• d4h7ma1 appears in SCOPe 2.07