Lineage for d1c1el1 (1c1e L:1-112)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 6995Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)
  6. 7065Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)
  7. 7324Species Diels alder catalytic Fab 1E9 (mouse), kappa L chain [48848] (1 PDB entry)
  8. 7326Domain d1c1el1: 1c1e L:1-112 [20238]
    Other proteins in same PDB: d1c1eh2, d1c1el2

Details for d1c1el1

PDB Entry: 1c1e (more details), 1.9 Å

PDB Description: crystal structure of a diels-alderase catalytic antibody 1e9 in complex with its hapten

SCOP Domain Sequences for d1c1el1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c1el1 b.1.1.1 (L:1-112) Immunoglobulin (variable domains of L and H chains) {Diels alder catalytic Fab 1E9 (mouse), kappa L chain}
elvmtqtplslpvslgdqasiscrssqslvhsngntylhwylqkpgqspkfliykvsnrf
sgvpdrfggsgsgtdfilkisrveaedlgvyfcfqsthffptfgggtkleiksadaa

SCOP Domain Coordinates for d1c1el1:

Click to download the PDB-style file with coordinates for d1c1el1.
(The format of our PDB-style files is described here.)

Timeline for d1c1el1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1c1el2