Lineage for d1a4kb1 (1a4k B:1-119)
- Root: SCOP 1.57
Class b: All beta proteins [48724] (104 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) 
Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species) 
Species Diels alder catalytic Fab (mouse), kappa L chain [48847] (2 PDB entries) 
Domain d1a4kb1: 1a4k B:1-119 [20237]
Other proteins in same PDB: d1a4ka2, d1a4kb2, d1a4kh2, d1a4kl2
Details for d1a4kb1
PDB Entry: 1a4k (more details), 2.4 Å
PDB Description: diels alder catalytic antibody with transition state analogue
SCOP Domain Sequences for d1a4kb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a4kb1 b.1.1.1 (B:1-119) Immunoglobulin (variable domains of L and H chains) {Diels alder catalytic Fab (mouse), kappa L chain}
qvqllesgpelkkpgetvkisckasgytftnygmnwvkqapgkglkwmgwintytgepty
addfkgrfafsletsastaylqinnlknedtatyfcvqaerlrrtfdywgagttvtvssa
stkgp
SCOP Domain Coordinates for d1a4kb1:
Click to download the PDB-style file with coordinates for d1a4kb1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1a4kb1:
View in 3D
