![]() | Class b: All beta proteins [48724] (93 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins) |
![]() | Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species) |
![]() | Species Diels alder catalytic Fab (mouse), kappa L chain [48847] (2 PDB entries) |
![]() | Domain d1a4kb1: 1a4k B:1-119 [20237] Other proteins in same PDB: d1a4ka2, d1a4kb2, d1a4kh2, d1a4kl2 |
PDB Entry: 1a4k (more details), 2.4 Å
SCOP Domain Sequences for d1a4kb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a4kb1 b.1.1.1 (B:1-119) Immunoglobulin (variable domains of L and H chains) {Diels alder catalytic Fab (mouse), kappa L chain} qvqllesgpelkkpgetvkisckasgytftnygmnwvkqapgkglkwmgwintytgepty addfkgrfafsletsastaylqinnlknedtatyfcvqaerlrrtfdywgagttvtvssa stkgp
Timeline for d1a4kb1: