Lineage for d4h5fb_ (4h5f B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2915150Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2915151Protein automated matches [190039] (161 species)
    not a true protein
  7. 2916177Species Streptococcus pneumoniae [TaxId:637987] [193477] (7 PDB entries)
  8. 2916188Domain d4h5fb_: 4h5f B: [202368]
    automated match to d4h5fc_
    complexed with act, arg, cl, edo, gol, peg, pge, so4

Details for d4h5fb_

PDB Entry: 4h5f (more details), 1.9 Å

PDB Description: Crystal structure of an amino acid ABC transporter substrate-binding protein from Streptococcus pneumoniae Canada MDR_19A bound to L-arginine, form 1
PDB Compounds: (B:) Amino acid ABC superfamily ATP binding cassette transporter, binding protein

SCOPe Domain Sequences for d4h5fb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4h5fb_ c.94.1.0 (B:) automated matches {Streptococcus pneumoniae [TaxId: 637987]}
qsaveaikqkgklvvatspdyapfefqslvdgknqvvgadidmaqaiadelgvkleilsm
sfdnvltslqtgkadlavagisatderkevfdfsipyyenkisflvhkadvekykdltsl
esaniaaqkgtvpesmvkeqlpkaqltsltnmgeavnelqagkidavhmdepvalsyaak
naglavatvslkmkdgdanavalrknsddlkevvdkviqklkdegtyqsylekaasltev

SCOPe Domain Coordinates for d4h5fb_:

Click to download the PDB-style file with coordinates for d4h5fb_.
(The format of our PDB-style files is described here.)

Timeline for d4h5fb_: