Class b: All beta proteins [48724] (176 folds) |
Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies) consists of six 4-stranded beta-sheet motifs; meander |
Superfamily b.68.1: Sialidases [50939] (3 families) |
Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 proteins) |
Protein automated matches [193245] (15 species) not a true protein |
Species Influenza a virus [TaxId:382827] [193246] (9 PDB entries) |
Domain d4h52b_: 4h52 B: [202366] automated match to d4h52a_ complexed with ca, fsi |
PDB Entry: 4h52 (more details), 1.8 Å
SCOPe Domain Sequences for d4h52b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4h52b_ b.68.1.1 (B:) automated matches {Influenza a virus [TaxId: 382827]} veyrnwskpqcqitgfapfskdnsirlsaggdiwvtrepyvscdpgkcyqfalgqgttld nkhsndtvhdriphrtllmnelgvpfhlgtrqvciawsssschdgkawlhvcitgddkna tasfiydgrlvdsigswsqnilrtqesecvcingtctvvmtdgsasgradtrilfieegk ivhisplsgsaqhieecscyprypgvrcicrdnwkgsnrpvvdinmedysidssyvcsgl vgdtprnddsssnsncrnpnnergtqgvkgwafdngndlwmgrtiskesrsgyetfkvig gwstpnsksqvnrqvivdnnnwsgysgifsvegkscinrcfyvelirgrpqetrvwwtsn sivvfcgtsgtygtgswpdganinfmpi
Timeline for d4h52b_: