SCOPe 2.05: Domain d4h52b_: 4h52 B:

Lineage for d4h52b_ (4h52 B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
   consists of six 4-stranded beta-sheet motifs; meander

4. Superfamily b.68.1: Sialidases [50939] (3 families)

5. Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 proteins)

6. Protein automated matches [193245] (15 species)
   not a true protein

7. Species Influenza a virus [TaxId:382827] [193246] (9 PDB entries)

8. Domain d4h52b_: 4h52 B: [202366]
   automated match to d4h52a_
   complexed with ca, fsi

Details for d4h52b_

PDB Entry: 4h52, 1.8 Å

PDB Description: wild-type influenza n2 neuraminidase covalent complex with 3-fluoro- neu5ac

PDB Compounds: (B:) Neuraminidase

SCOPe Domain Sequences for d4h52b_:

Sequence; same for both SEQRES and ATOM records:

>d4h52b_ b.68.1.1 (B:) automated matches {Influenza a virus [TaxId: 382827]}
veyrnwskpqcqitgfapfskdnsirlsaggdiwvtrepyvscdpgkcyqfalgqgttld
nkhsndtvhdriphrtllmnelgvpfhlgtrqvciawsssschdgkawlhvcitgddkna
tasfiydgrlvdsigswsqnilrtqesecvcingtctvvmtdgsasgradtrilfieegk
ivhisplsgsaqhieecscyprypgvrcicrdnwkgsnrpvvdinmedysidssyvcsgl
vgdtprnddsssnsncrnpnnergtqgvkgwafdngndlwmgrtiskesrsgyetfkvig
gwstpnsksqvnrqvivdnnnwsgysgifsvegkscinrcfyvelirgrpqetrvwwtsn
sivvfcgtsgtygtgswpdganinfmpi

Timeline for d4h52b_:

• d4h52b_ first appeared in SCOPe 2.03
  
• d4h52b_ appears in SCOPe 2.04
  
• d4h52b_ appears in SCOPe 2.06
  
• d4h52b_ appears in the current release, SCOPe 2.08