SCOP 1.73: Domain d1a4kh1: 1a4k H:1-119

Lineage for d1a4kh1 (1a4k H:1-119)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88554] (32 PDB entries)

8. Domain d1a4kh1: 1a4k H:1-119 [20235]
   Other proteins in same PDB: d1a4ka1, d1a4ka2, d1a4kb2, d1a4kh2, d1a4kl1, d1a4kl2

Details for d1a4kh1

PDB Entry: 1a4k, 2.4 Å

PDB Description: diels alder catalytic antibody with transition state analogue

PDB Compounds: (H:) antibody fab

SCOP Domain Sequences for d1a4kh1:

Sequence; same for both SEQRES and ATOM records:

>d1a4kh1 b.1.1.1 (H:1-119) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 4 [TaxId: 10090]}
qvqllesgpelkkpgetvkisckasgytftnygmnwvkqapgkglkwmgwintytgepty
addfkgrfafsletsastaylqinnlknedtatyfcvqaerlrrtfdywgagttvtvssa
stkgp

Timeline for d1a4kh1:

• d1a4kh1 first appeared (with stable ids) in SCOP 1.55
  
• d1a4kh1 appears in SCOP 1.71
  
• d1a4kh1 appears in SCOP 1.75
  
• d1a4kh1 appears in the current release, SCOPe 2.08