Lineage for d1a4jb1 (1a4j B:1-119)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 51642Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 51698Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)
  7. 51971Species Diels alder catalytic Fab (mouse), kappa L chain [48847] (2 PDB entries)
  8. 51973Domain d1a4jb1: 1a4j B:1-119 [20233]
    Other proteins in same PDB: d1a4ja2, d1a4jb2, d1a4jh2, d1a4jl2

Details for d1a4jb1

PDB Entry: 1a4j (more details), 2.1 Å

PDB Description: diels alder catalytic antibody germline precursor

SCOP Domain Sequences for d1a4jb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a4jb1 b.1.1.1 (B:1-119) Immunoglobulin (variable domains of L and H chains) {Diels alder catalytic Fab (mouse), kappa L chain}
qvqllesgpelkkpgetvkisckasgytftnygmnwvkqapgkglkwmgwintytgepty
addfkgrfafsletsastaylqinnlknedtatyfcvqaerlrrtfdywgagttvtvss

SCOP Domain Coordinates for d1a4jb1:

Click to download the PDB-style file with coordinates for d1a4jb1.
(The format of our PDB-style files is described here.)

Timeline for d1a4jb1: