Lineage for d4gzxb_ (4gzx B:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1326286Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 1326287Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 1326288Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 proteins)
  6. 1326557Protein automated matches [193245] (7 species)
    not a true protein
  7. 1326566Species Influenza a virus [TaxId:119210] [193455] (7 PDB entries)
  8. 1326582Domain d4gzxb_: 4gzx B: [202319]
    automated match to d4gzxa_
    complexed with ca, nag, sia; mutant

Details for d4gzxb_

PDB Entry: 4gzx (more details), 2.45 Å

PDB Description: n2 neuraminidase d151g mutant of a/tanzania/205/2010 h3n2 in complex with human sialic acid receptor
PDB Compounds: (B:) Neuraminidase

SCOPe Domain Sequences for d4gzxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gzxb_ b.68.1.1 (B:) automated matches {Influenza a virus [TaxId: 119210]}
aeyrnwskpqcditgfapfskdnsirlsaggdiwvtrepyvscdpdkcyqfalgqgttln
nvhsnntvrgrtpyrtllmnelgvpfhlgtkqvciawsssschdgkawlhvcitgddkna
tasfiyngrlvdsvvswskeilrtqesecvcingtctvvmtdgsasgkadtkilfieegk
ivhtstlsgsaqhveecscyprypgvrcvcrdnwkgsnrpivdinikdhsivssyvcsgl
vgdtprkndssssshcldpnneegghgvkgwafddgndvwmgrtinetsrlgyetfkvie
gwsnpksklqinrqvivdrgnrsgysgifsvegkscinrcfyvelirgrkeetevlwtsn
sivvfcgtsgtygtgswpdgadlnlmpi

SCOPe Domain Coordinates for d4gzxb_:

Click to download the PDB-style file with coordinates for d4gzxb_.
(The format of our PDB-style files is described here.)

Timeline for d4gzxb_: