SCOPe 2.06: Domain d4gyqd_: 4gyq D:

Lineage for d4gyqd_ (4gyq D:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families)

5. Family d.157.1.0: automated matches [191360] (1 protein)
   not a true family

6. Protein automated matches [190418] (18 species)
   not a true protein

7. Species Klebsiella pneumoniae [TaxId:573] [189718] (37 PDB entries)

8. Domain d4gyqd_: 4gyq D: [202313]
   automated match to d4gyqc_
   complexed with edo, mg; mutant

Details for d4gyqd_

PDB Entry: 4gyq, 1.35 Å

PDB Description: crystal structure of new delhi metallo-beta-lactamase-1 d223a mutant from klebsiella pneumoniae

PDB Compounds: (D:) Beta-lactamase NDM-1

SCOPe Domain Sequences for d4gyqd_:

Sequence; same for both SEQRES and ATOM records:

>d4gyqd_ d.157.1.0 (D:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
tgdqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlvvdtawtddqtaq
ilnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqegmvaaqhs
ltfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclikdskakslgn
lgaadtehyaasarafgaafpkasmivmshsapdsraaithtarmadklr

Timeline for d4gyqd_:

• d4gyqd_ first appeared in SCOPe 2.03
  
• d4gyqd_ appears in SCOPe 2.05
  
• d4gyqd_ appears in SCOPe 2.07
  
• d4gyqd_ appears in the current release, SCOPe 2.08