SCOPe 2.05: Domain d4gxxe_: 4gxx E:

Lineage for d4gxxe_ (4gxx E:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)

6. Protein Hemagglutinin [49824] (7 species)
   includes rudiment esterase domain

7. Species Influenza a virus (a/brevig mission/1/1918(h1n1)) [TaxId:88776] [188803] (3 PDB entries)

8. Domain d4gxxe_: 4gxx E: [202310]
   Other proteins in same PDB: d4gxxb_, d4gxxd_, d4gxxf_
   automated match to d4gxxc_
   complexed with nag

Details for d4gxxe_

PDB Entry: 4gxx, 1.8 Å

PDB Description: crystal structure of the "avianized" 1918 influenza virus hemagglutinin

PDB Compounds: (E:) Hemagglutinin HA1 chain

SCOPe Domain Sequences for d4gxxe_:

Sequence; same for both SEQRES and ATOM records:

>d4gxxe_ b.19.1.2 (E:) Hemagglutinin {Influenza a virus (a/brevig mission/1/1918(h1n1)) [TaxId: 88776]}
pgdticigyhannstdtvdtvleknvtvthsvnlledshngklcklkgiaplqlgkcnia
gwllgnpecdllltasswsyivetsnsengtcypgdfidyeelreqlssvssfekfeifp
ktsswpnhettkgvtaacsyagassfyrnllwltkkgssypklsksyvnnkgkevlvlwg
vhhpptgteqqslyqnadayvsvgsskynrrftpeiaarpkvrgqagrmnyywtllepgd
titfeatgnliapwyafalnrgsgsgiitsdapvhdcntkcqtphgainsslpfqnihpv
tigecpkyvrstklrmatglrnips

Timeline for d4gxxe_:

• d4gxxe_ first appeared in SCOPe 2.03
  
• d4gxxe_ appears in SCOPe 2.04
  
• d4gxxe_ is called d4gxxe1 in SCOPe 2.06
  
• d4gxxe_ appears in the current release, SCOPe 2.08, called d4gxxe1