SCOP 1.55: Domain d1a4jh1: 1a4j H:1-119

Lineage for d1a4jh1 (1a4j H:1-119)

Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)
Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)
Species Diels alder catalytic Fab (mouse), kappa L chain [48847] (2 PDB entries)
Domain d1a4jh1: 1a4j H:1-119 [20231]
Other proteins in same PDB: d1a4ja2, d1a4jb2, d1a4jh2, d1a4jl2

Details for d1a4jh1

PDB Entry: 1a4j (more details), 2.1 Å

PDB Description: diels alder catalytic antibody germline precursor

SCOP Domain Sequences for d1a4jh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a4jh1 b.1.1.1 (H:1-119) Immunoglobulin (variable domains of L and H chains) {Diels alder catalytic Fab (mouse), kappa L chain}
qvqllesgpelkkpgetvkisckasgytftnygmnwvkqapgkglkwmgwintytgepty
addfkgrfafsletsastaylqinnlknedtatyfcvqaerlrrtfdywgagttvtvss

SCOP Domain Coordinates for d1a4jh1:

Click to download the PDB-style file with coordinates for d1a4jh1.
(The format of our PDB-style files is described here.)

Timeline for d1a4jh1: