Lineage for d4gvha_ (4gvh A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2093018Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2095300Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2095301Protein automated matches [190075] (90 species)
    not a true protein
  7. 2095889Species Salmonella enterica [TaxId:99287] [194211] (5 PDB entries)
  8. 2095892Domain d4gvha_: 4gvh A: [202303]
    automated match to d4gvhb_
    complexed with 0xy, mes

Details for d4gvha_

PDB Entry: 4gvh (more details), 1.45 Å

PDB Description: crystal structure of salmonella typhimurium family 3 glycoside hydrolase (nagz) covalently bound to 5-fluoro-glcnac.
PDB Compounds: (A:) Beta-hexosaminidase

SCOPe Domain Sequences for d4gvha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gvha_ c.1.8.0 (A:) automated matches {Salmonella enterica [TaxId: 99287]}
mgpvmlnvegceldaeereilahplvgglilftrnyhdpeqlrelvrqiraasrnhlvva
vdqeggrvqrfregftrlpaaqsffalhgleeggrlaqeagwlmasemiamdidisfapv
ldvghisaaigersyhadpakalamatrfidgmhdagmkttgkhfpghgavtadshketp
cdprpetdirgkdmsvfrtlisenkldaimpahviyraidprpasgspywlktvlrqelg
fdgvifsddlsmegaaimgsyaeraqasldagcdmilvcnnrkgavsvldnlspikaerv
trlyhkgsfsrrelmdsarwktasaqlnqlherwqeekagh

SCOPe Domain Coordinates for d4gvha_:

Click to download the PDB-style file with coordinates for d4gvha_.
(The format of our PDB-style files is described here.)

Timeline for d4gvha_: