Lineage for d1a4jl1 (1a4j L:1-112)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 218899Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)
  6. 218958Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)
  7. 219357Species Diels-Alder catalytic Fab (mouse), kappa L chain [48847] (2 PDB entries)
  8. 219361Domain d1a4jl1: 1a4j L:1-112 [20230]
    Other proteins in same PDB: d1a4ja2, d1a4jb2, d1a4jh2, d1a4jl2

Details for d1a4jl1

PDB Entry: 1a4j (more details), 2.1 Å

PDB Description: diels alder catalytic antibody germline precursor

SCOP Domain Sequences for d1a4jl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a4jl1 b.1.1.1 (L:1-112) Immunoglobulin (variable domains of L and H chains) {Diels-Alder catalytic Fab (mouse), kappa L chain}
elvmtqtplslpvslgdqasiscrssqslvhsngntylhwylqkpgqspklliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqsthvpptfgggtkleik

SCOP Domain Coordinates for d1a4jl1:

Click to download the PDB-style file with coordinates for d1a4jl1.
(The format of our PDB-style files is described here.)

Timeline for d1a4jl1: