Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (2 families) |
Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
Protein Interleukin-2 receptor beta chain [141047] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [141048] (3 PDB entries) Uniprot P14784 130-232! Uniprot P14784 130-233! Uniprot P14784 32-129 |
Domain d4gs7b1: 4gs7 B:6-103 [202293] Other proteins in same PDB: d4gs7a_, d4gs7c1, d4gs7c2, d4gs7d_ automated match to d2b5ib1 complexed with act, edo, nag |
PDB Entry: 4gs7 (more details), 2.35 Å
SCOPe Domain Sequences for d4gs7b1:
Sequence, based on SEQRES records: (download)
>d4gs7b1 b.1.2.1 (B:6-103) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} sqftcfynsraqiscvwsqdgalqdtscqvhawpdrrrwqqtcellpvsqaswacnlilg apdsqklttvdivtlrvlcregvrwrvmaiqdfkpfen
>d4gs7b1 b.1.2.1 (B:6-103) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} sqftcfynsraqiscvwsqtscqvhawpdrrrwqqtcellpvsqaswacnlilgapdsqk lttvdivtlrvlcregvrwrvmaiqdfkpfen
Timeline for d4gs7b1:
View in 3D Domains from other chains: (mouse over for more information) d4gs7a_, d4gs7c1, d4gs7c2, d4gs7d_ |