SCOP 1.59: Domain d1kb5l1: 1kb5 L:1-108

Lineage for d1kb5l1 (1kb5 L:1-108)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)

7. Species Fab Desire-1 (mouse), kappa L chain [48846] (1 PDB entry)

8. Domain d1kb5l1: 1kb5 L:1-108 [20228]
   Other proteins in same PDB: d1kb5a_, d1kb5b_, d1kb5h2, d1kb5l2

Details for d1kb5l1

PDB Entry: 1kb5, 2.5 Å

PDB Description: murine t-cell receptor variable domain/fab complex

SCOP Domain Sequences for d1kb5l1:

Sequence; same for both SEQRES and ATOM records:

>d1kb5l1 b.1.1.1 (L:1-108) Immunoglobulin (variable domains of L and H chains) {Fab Desire-1 (mouse), kappa L chain}
diqmtqspaslsasvgetvtitcraskniysylawyqqkqgkspqllvynaktlgegvps
rfsgsgsgtqfslkinslqpedfgsyycqhhygtpytfgggtkleikr

Timeline for d1kb5l1:

• d1kb5l1 first appeared (with stable ids) in SCOP 1.55
  
• d1kb5l1 appears in SCOP 1.57
  
• d1kb5l1 appears in SCOP 1.61
  
• d1kb5l1 appears in the current release, SCOPe 2.08