Lineage for d1kb5l1 (1kb5 L:1-108)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 6995Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)
  6. 7065Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)
  7. 7665Species Fab Desire-1 (mouse), kappa L chain [48846] (1 PDB entry)
  8. 7667Domain d1kb5l1: 1kb5 L:1-108 [20228]
    Other proteins in same PDB: d1kb5a_, d1kb5b_, d1kb5h2, d1kb5l2

Details for d1kb5l1

PDB Entry: 1kb5 (more details), 2.5 Å

PDB Description: murine t-cell receptor variable domain/fab complex

SCOP Domain Sequences for d1kb5l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kb5l1 b.1.1.1 (L:1-108) Immunoglobulin (variable domains of L and H chains) {Fab Desire-1 (mouse), kappa L chain}
diqmtqspaslsasvgetvtitcraskniysylawyqqkqgkspqllvynaktlgegvps
rfsgsgsgtqfslkinslqpedfgsyycqhhygtpytfgggtkleikr

SCOP Domain Coordinates for d1kb5l1:

Click to download the PDB-style file with coordinates for d1kb5l1.
(The format of our PDB-style files is described here.)

Timeline for d1kb5l1: