SCOPe 2.02: Domain d1jrhh1: 1jrh H:1-113

Lineage for d1jrhh1 (1jrh H:1-113)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 6 [TaxId:10090] [88556] (12 PDB entries)
   SQ NA # part of Fab 28 against HIV-1 RT

8. Domain d1jrhh1: 1jrh H:1-113 [20223]
   Other proteins in same PDB: d1jrhh2, d1jrhi_, d1jrhl1, d1jrhl2
   part of Fab A6

Details for d1jrhh1

PDB Entry: 1jrh, 2.8 Å

PDB Description: complex (antibody/antigen)

PDB Compounds: (H:) antibody a6

SCOPe Domain Sequences for d1jrhh1:

Sequence; same for both SEQRES and ATOM records:

>d1jrhh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 6 [TaxId: 10090]}
avklqesgpgilkpsqtlsltcsfsgfslttygmgvgwirqssgkglewlahiwwdddky
ynpslksrltiskdtsrnqvflkitsvatadtatyycarrapfygnhamdywgqgttvtv
ss

Timeline for d1jrhh1:

• d1jrhh1 first appeared (with stable ids) in SCOP 1.55
  
• d1jrhh1 appears in SCOPe 2.01
  
• d1jrhh1 appears in SCOPe 2.03
  
• d1jrhh1 appears in the current release, SCOPe 2.08