Lineage for d4gamd_ (4gam D:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2216843Fold d.137: Monooxygenase (hydroxylase) regulatory protein [56028] (1 superfamily)
    corner-like structure formed by two sheets and filled in with 2-3 helices
  4. 2216844Superfamily d.137.1: Monooxygenase (hydroxylase) regulatory protein [56029] (1 family) (S)
    duplication: consists of two beta-alpha-(beta)-beta(2) motifs; some topological similarity to the ferredoxin-like fold
  5. 2216845Family d.137.1.1: Monooxygenase (hydroxylase) regulatory protein [56030] (4 proteins)
    note: the solution structure determinations disagree in the relative orientations of two motifs
  6. 2216849Protein Soluble methane monooxygenase regulatory protein B [56031] (3 species)
  7. 2216852Species Methylococcus capsulatus [TaxId:243233] [194030] (1 PDB entry)
  8. 2216853Domain d4gamd_: 4gam D: [202225]
    Other proteins in same PDB: d4gama_, d4gamb_, d4gamc_, d4gamf_, d4gamg_, d4gamh_, d4gamk_, d4gaml_, d4gamm_, d4gamp_, d4gamq_, d4gamr_
    automated match to d1ckva_
    complexed with fe

Details for d4gamd_

PDB Entry: 4gam (more details), 2.9 Å

PDB Description: Complex structure of Methane monooxygenase hydroxylase and regulatory subunit
PDB Compounds: (D:) Methane monooxygenase regulatory protein B

SCOPe Domain Sequences for d4gamd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gamd_ d.137.1.1 (D:) Soluble methane monooxygenase regulatory protein B {Methylococcus capsulatus [TaxId: 243233]}
svnsnaydagimglkgkdfadqffadenqvvhesdtvvlvlkksdeintfieeilltdyk
knvnptvnvedragywwikangkievdcdeisellgrqfnvydflvdvsstigraytlgn
kftitselmgld

SCOPe Domain Coordinates for d4gamd_:

Click to download the PDB-style file with coordinates for d4gamd_.
(The format of our PDB-style files is described here.)

Timeline for d4gamd_: