![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.23: Open three-helical up-and-down bundle [47143] (7 superfamilies) core: 3 helices; bundle, open |
![]() | Superfamily a.23.3: Methane monooxygenase hydrolase, gamma subunit [47152] (1 family) ![]() duplication: consists of two domains of this fold automatically mapped to Pfam PF02964 |
![]() | Family a.23.3.1: Methane monooxygenase hydrolase, gamma subunit [47153] (2 proteins) |
![]() | Protein Methane monooxygenase hydrolase, gamma subunit [47154] (2 species) |
![]() | Species Methylococcus capsulatus [TaxId:414] [47155] (27 PDB entries) |
![]() | Domain d4gamc_: 4gam C: [202224] Other proteins in same PDB: d4gama_, d4gamb_, d4gamd_, d4gamf_, d4gamg_, d4gami_, d4gamk_, d4gaml_, d4gamn_, d4gamp_, d4gamq_, d4gams_ automated match to d1fz1e_ complexed with fe |
PDB Entry: 4gam (more details), 2.9 Å
SCOPe Domain Sequences for d4gamc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4gamc_ a.23.3.1 (C:) Methane monooxygenase hydrolase, gamma subunit {Methylococcus capsulatus [TaxId: 414]} klgihsndtrdawvnkiaqlntlekaaemlkqfrmdhttpfrnsyeldndylwieaklee kvavlkarafnevdfrhktafgedaksvldgtvakmnaakdkweaekihigfrqaykppi mpvnyfldgerqlgtrlmelrnlnyydtpleelrkqrgvrvvhlqs
Timeline for d4gamc_: