Lineage for d4gamb_ (4gam B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1989402Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1989403Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1991094Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)
  6. 1991179Protein Methane monooxygenase hydrolase beta subunit [88792] (2 species)
  7. 1991180Species Methylococcus capsulatus [TaxId:414] [88793] (27 PDB entries)
  8. 1991231Domain d4gamb_: 4gam B: [202223]
    Other proteins in same PDB: d4gama_, d4gamc_, d4gamd_, d4gamf_, d4gamh_, d4gami_, d4gamk_, d4gamm_, d4gamn_, d4gamp_, d4gamr_, d4gams_
    automated match to d1fz1c_
    complexed with fe

Details for d4gamb_

PDB Entry: 4gam (more details), 2.9 Å

PDB Description: Complex structure of Methane monooxygenase hydroxylase and regulatory subunit
PDB Compounds: (B:) Methane monooxygenase component A beta chain

SCOPe Domain Sequences for d4gamb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gamb_ a.25.1.2 (B:) Methane monooxygenase hydrolase beta subunit {Methylococcus capsulatus [TaxId: 414]}
smlgerrrgltdpemaavilkalpeapldgnnkmgyfvtprwkrlteyealtvyaqpnad
wiaggldwgdwtqkfhggrpswgnettelrtvdwfkhrdplrrwhapyvkdkaeewrytd
rflqgysadgqiramnptwrdefinrywgaflfneyglfnahsqgarealsdvtrvslaf
wgfdkidiaqmiqlergflakivpgfdestavpkaewtngevyksarlaveglwqevfdw
nesafsvhavydalfgqfvrreffqrlaprfgdnltpffinqaqtyfqiakqgvqdlyyn
clgddpefsdynrtvmrnwtgkwleptiaalrdfmglfaklpagttdkeeitaslyrvvd
dwiedyasridfkadrdqivkavlaglk

SCOPe Domain Coordinates for d4gamb_:

Click to download the PDB-style file with coordinates for d4gamb_.
(The format of our PDB-style files is described here.)

Timeline for d4gamb_: