SCOPe 2.08: Domain d4g7ob1: 4g7o B:7-49,B:173-228

Lineage for d4g7ob1 (4g7o B:7-49,B:173-228)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.74: DCoH-like [55247] (5 superfamilies)
   beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta

4. Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (3 families)
   form homo and heterodimers

5. Family d.74.3.1: RNA polymerase alpha subunit dimerisation domain [55258] (3 proteins)

6. Protein RNA polymerase alpha [55259] (3 species)

7. Species Thermus thermophilus [TaxId:274] [75478] (16 PDB entries)
   Uniprot Q9Z9H6; part of multichain biological unit

8. Domain d4g7ob1: 4g7o B:7-49,B:173-228 [202207]
   Other proteins in same PDB: d4g7oa2, d4g7ob2, d4g7oc_, d4g7od_, d4g7oe_, d4g7of1, d4g7of2, d4g7of3, d4g7ok2, d4g7ol2, d4g7om_, d4g7on_, d4g7oo_, d4g7op1, d4g7op2, d4g7op3
   automated match to d1smya1
   protein/DNA complex; protein/RNA complex; complexed with mg, zn

Details for d4g7ob1

PDB Entry: 4g7o, 2.99 Å

PDB Description: Crystal structure of Thermus thermophilus transcription initiation complex containing 2 nt of RNA

PDB Compounds: (B:) DNA-directed RNA polymerase subunit alpha

SCOPe Domain Sequences for d4g7ob1:

Sequence; same for both SEQRES and ATOM records:

>d4g7ob1 d.74.3.1 (B:7-49,B:173-228) RNA polymerase alpha {Thermus thermophilus [TaxId: 274]}
kapvftvrtqgreygefvleplergfgvtlgnplrrillssipXpvrrvafqvedtrlgq
rtdldkltlriwtdgsvtplealnqaveilrehltyfsnp

Timeline for d4g7ob1:

• d4g7ob1 first appeared in SCOPe 2.03
  
• d4g7ob1 appears in SCOPe 2.07