Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.74: DCoH-like [55247] (5 superfamilies) beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta |
Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (3 families) form homo and heterodimers |
Family d.74.3.1: RNA polymerase alpha subunit dimerisation domain [55258] (3 proteins) |
Protein RNA polymerase alpha [55259] (3 species) |
Species Thermus thermophilus [TaxId:274] [75478] (16 PDB entries) Uniprot Q9Z9H6; part of multichain biological unit |
Domain d4g7ob1: 4g7o B:7-49,B:173-228 [202207] Other proteins in same PDB: d4g7oa2, d4g7ob2, d4g7oc_, d4g7od_, d4g7oe_, d4g7of1, d4g7of2, d4g7of3, d4g7ok2, d4g7ol2, d4g7om_, d4g7on_, d4g7oo_, d4g7op1, d4g7op2, d4g7op3 automated match to d1smya1 protein/DNA complex; protein/RNA complex; complexed with mg, zn |
PDB Entry: 4g7o (more details), 2.99 Å
SCOPe Domain Sequences for d4g7ob1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4g7ob1 d.74.3.1 (B:7-49,B:173-228) RNA polymerase alpha {Thermus thermophilus [TaxId: 274]} kapvftvrtqgreygefvleplergfgvtlgnplrrillssipXpvrrvafqvedtrlgq rtdldkltlriwtdgsvtplealnqaveilrehltyfsnp
Timeline for d4g7ob1: