SCOP 1.73: Domain d1ahwd1: 1ahw D:1-108

Lineage for d1ahwd1 (1ahw D:1-108)

Root: SCOP 1.73
Class b: All beta proteins [48724] (165 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (4 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)

Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (181 PDB entries)
Domain d1ahwd1: 1ahw D:1-108 [20220]
Other proteins in same PDB: d1ahwa2, d1ahwb1, d1ahwb2, d1ahwc1, d1ahwc2, d1ahwd2, d1ahwe1, d1ahwe2, d1ahwf1, d1ahwf2
part of anti-human tissue factor Fab 5G9

Details for d1ahwd1

PDB Entry: 1ahw (more details), 3 Å

PDB Description: a complex of extracellular domain of tissue factor with an inhibitory fab (5g9)

PDB Compounds: (D:) immunoglobulin fab 5g9 (light chain)

SCOP Domain Sequences for d1ahwd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ahwd1 b.1.1.1 (D:1-108) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]}
dikmtqspssmyaslgervtitckasqdirkylnwyqqkpwkspktliyyatsladgvps
rfsgsgsgqdysltisslesddtatyyclqhgespytfgggtkleinr

SCOP Domain Coordinates for d1ahwd1:

Click to download the PDB-style file with coordinates for d1ahwd1.
(The format of our PDB-style files is described here.)

Timeline for d1ahwd1: