Lineage for d4g4sd_ (4g4s D:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548740Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2548741Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2548925Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2549037Protein Proteasome alpha subunit (non-catalytic) [56255] (9 species)
    contains an extension to the common fold at the N-terminus
  7. 2549053Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56257] (237 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 2549073Domain d4g4sd_: 4g4s D: [202185]
    Other proteins in same PDB: d4g4sb_, d4g4sh_, d4g4si_, d4g4sj_, d4g4sk_, d4g4sm_, d4g4sn_
    automated match to d2zcyc_
    complexed with ldz, mg

Details for d4g4sd_

PDB Entry: 4g4s (more details), 2.49 Å

PDB Description: Structure of Proteasome-Pba1-Pba2 Complex
PDB Compounds: (D:) Proteasome component PRE6

SCOPe Domain Sequences for d4g4sd_:

Sequence, based on SEQRES records: (download)

>d4g4sd_ d.153.1.4 (D:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritpskvskid
shvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytqsggvrp
fgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrkeppatv
eecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqie

Sequence, based on observed residues (ATOM records): (download)

>d4g4sd_ d.153.1.4 (D:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sifspdghifqveyaleavkrgtcavgvkgkncvvlgcerklqdtritpskvskidshvv
lsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytqsggvrpfgvs
tliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrkeppatveecv
kltvrsllevvnieitvvkpdsdivalsseeinqyvtqie

SCOPe Domain Coordinates for d4g4sd_:

Click to download the PDB-style file with coordinates for d4g4sd_.
(The format of our PDB-style files is described here.)

Timeline for d4g4sd_: