Lineage for d1ahwa1 (1ahw A:1-108)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 651989Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)
  6. 652980Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 653521Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (181 PDB entries)
  8. 653710Domain d1ahwa1: 1ahw A:1-108 [20218]
    Other proteins in same PDB: d1ahwa2, d1ahwb1, d1ahwb2, d1ahwc1, d1ahwc2, d1ahwd2, d1ahwe1, d1ahwe2, d1ahwf1, d1ahwf2

Details for d1ahwa1

PDB Entry: 1ahw (more details), 3 Å

PDB Description: a complex of extracellular domain of tissue factor with an inhibitory fab (5g9)
PDB Compounds: (A:) immunoglobulin fab 5g9 (light chain)

SCOP Domain Sequences for d1ahwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ahwa1 b.1.1.1 (A:1-108) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]}
dikmtqspssmyaslgervtitckasqdirkylnwyqqkpwkspktliyyatsladgvps
rfsgsgsgqdysltisslesddtatyyclqhgespytfgggtkleinr

SCOP Domain Coordinates for d1ahwa1:

Click to download the PDB-style file with coordinates for d1ahwa1.
(The format of our PDB-style files is described here.)

Timeline for d1ahwa1: