SCOP 1.63: Domain d1ahwa1: 1ahw A:1-108

Lineage for d1ahwa1 (1ahw A:1-108)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)

7. Species Anti-human tissue factor Fab 5G9 (mouse), kappa L chain [48843] (2 PDB entries)

8. Domain d1ahwa1: 1ahw A:1-108 [20218]
   Other proteins in same PDB: d1ahwa2, d1ahwb2, d1ahwc1, d1ahwc2, d1ahwd2, d1ahwe2, d1ahwf1, d1ahwf2

Details for d1ahwa1

PDB Entry: 1ahw, 3 Å

PDB Description: a complex of extracellular domain of tissue factor with an inhibitory fab (5g9)

SCOP Domain Sequences for d1ahwa1:

Sequence; same for both SEQRES and ATOM records:

>d1ahwa1 b.1.1.1 (A:1-108) Immunoglobulin (variable domains of L and H chains) {Anti-human tissue factor Fab 5G9 (mouse), kappa L chain}
dikmtqspssmyaslgervtitckasqdirkylnwyqqkpwkspktliyyatsladgvps
rfsgsgsgqdysltisslesddtatyyclqhgespytfgggtkleinr

Timeline for d1ahwa1:

• d1ahwa1 first appeared (with stable ids) in SCOP 1.55
  
• d1ahwa1 appears in SCOP 1.61
  
• d1ahwa1 appears in SCOP 1.65
  
• d1ahwa1 appears in the current release, SCOPe 2.08