SCOPe 2.05: Domain d4g3yl1: 4g3y L:1-107

Lineage for d4g3yl1 (4g3y L:1-107)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries)

8. Domain d4g3yl1: 4g3y L:1-107 [202171]
   Other proteins in same PDB: d4g3yc_, d4g3yl2
   automated match to d1rhha1

Details for d4g3yl1

PDB Entry: 4g3y, 2.6 Å

PDB Description: Crystal structure of TNF-alpha in complex with Infliximab Fab fragment

PDB Compounds: (L:) infliximab Fab L

SCOPe Domain Sequences for d4g3yl1:

Sequence; same for both SEQRES and ATOM records:

>d4g3yl1 b.1.1.0 (L:1-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dilltqspailsvspgervsfscrasqfvgssihwyqqrtngsprllikyasesmsgips
rfsgsgsgtdftlsintvesediadyycqqshswpftfgsgtnlevk

Timeline for d4g3yl1:

• d4g3yl1 first appeared in SCOPe 2.03
  
• d4g3yl1 appears in SCOPe 2.04
  
• d4g3yl1 appears in SCOPe 2.06
  
• d4g3yl1 appears in the current release, SCOPe 2.08