SCOP 1.55: Domain d1fgnl1: 1fgn L:1-108

Lineage for d1fgnl1 (1fgn L:1-108)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)

7. Species Fab 5G9 (mouse), kappa L chain [48843] (2 PDB entries)

8. Domain d1fgnl1: 1fgn L:1-108 [20216]
   Other proteins in same PDB: d1fgnh2, d1fgnl2

Details for d1fgnl1

PDB Entry: 1fgn, 2.5 Å

PDB Description: monoclonal murine antibody 5g9-anti-human tissue factor

SCOP Domain Sequences for d1fgnl1:

Sequence; same for both SEQRES and ATOM records:

>d1fgnl1 b.1.1.1 (L:1-108) Immunoglobulin (variable domains of L and H chains) {Fab 5G9 (mouse), kappa L chain}
dikmtqspssmyaslgervtitckasqdirkylnwyqqkpwkspktliyyatsladgvps
rfsgsgsgqdysltisslesddtatyyclqhgespytfgggtkleinr

Timeline for d1fgnl1:

• d1fgnl1 appears in SCOP 1.57
  
• d1fgnl1 appears in the current release, SCOPe 2.08