Class b: All beta proteins [48724] (110 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species) |
Species Fab CTM01 (human construct), kappa L chain [48842] (1 PDB entry) |
Domain d1ad9b1: 1ad9 B:1-113 [20215] Other proteins in same PDB: d1ad9a2, d1ad9b2, d1ad9h2, d1ad9l2 |
PDB Entry: 1ad9 (more details), 2.8 Å
SCOP Domain Sequences for d1ad9b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ad9b1 b.1.1.1 (B:1-113) Immunoglobulin (variable domains of L and H chains) {Fab CTM01 (human construct), kappa L chain} eiqlvqsgaevkkpgssvkvsckasgytftdyyinwmrqapgqglewigwidpgsgntky nekfkgratltvdtstntaymelsslrsedtafyfcarekttyyyamdywgqgtlvtvss
Timeline for d1ad9b1: