Lineage for d1ad9b1 (1ad9 B:1-113)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 101939Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 101995Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)
  7. 102596Species Fab CTM01 (human construct), kappa L chain [48842] (1 PDB entry)
  8. 102598Domain d1ad9b1: 1ad9 B:1-113 [20215]
    Other proteins in same PDB: d1ad9a2, d1ad9b2, d1ad9h2, d1ad9l2

Details for d1ad9b1

PDB Entry: 1ad9 (more details), 2.8 Å

PDB Description: igg-fab fragment of engineered human monoclonal antibody ctm01

SCOP Domain Sequences for d1ad9b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ad9b1 b.1.1.1 (B:1-113) Immunoglobulin (variable domains of L and H chains) {Fab CTM01 (human construct), kappa L chain}
eiqlvqsgaevkkpgssvkvsckasgytftdyyinwmrqapgqglewigwidpgsgntky
nekfkgratltvdtstntaymelsslrsedtafyfcarekttyyyamdywgqgtlvtvss

SCOP Domain Coordinates for d1ad9b1:

Click to download the PDB-style file with coordinates for d1ad9b1.
(The format of our PDB-style files is described here.)

Timeline for d1ad9b1: