SCOPe 2.05: Domain d4fxpb_: 4fxp B:

Lineage for d4fxpb_ (4fxp B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (96 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [189883] (5 PDB entries)

8. Domain d4fxpb_: 4fxp B: [202146]
   automated match to d3uieb_
   complexed with adx, so4

Details for d4fxpb_

PDB Entry: 4fxp, 1.95 Å

PDB Description: Crystal structure of adenosine 5'-phosphosulfate kinase from Arabidopsis thaliana in Complex with Sulfate and APS

PDB Compounds: (B:) Adenylyl-sulfate kinase 1, chloroplastic

SCOPe Domain Sequences for d4fxpb_:

Sequence; same for both SEQRES and ATOM records:

>d4fxpb_ c.37.1.0 (B:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
nstnikwhecsvekvdrqrlldqkgcviwvtglsgsgkstlacalnqmlyqkgklcyild
gdnvrhglnrdlsfkaedraenirrvgevaklfadagiiciaslispyrtdrdacrsllp
egdfvevfmdvplsvceardpkglyklaragkikgftgiddpyepplnceislgreggts
piemaekvvgyldnkgylqa

Timeline for d4fxpb_:

• d4fxpb_ first appeared in SCOPe 2.03
  
• d4fxpb_ appears in SCOPe 2.04
  
• d4fxpb_ appears in SCOPe 2.06
  
• d4fxpb_ appears in the current release, SCOPe 2.08