Lineage for d1ad9a1 (1ad9 A:1-107)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 287097Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)
  6. 287738Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogeneous CDRs are listed as engineered species
  7. 287739Species Engineered (including hybrid species) [88533] (25 PDB entries)
  8. 287766Domain d1ad9a1: 1ad9 A:1-107 [20214]
    Other proteins in same PDB: d1ad9a2, d1ad9b1, d1ad9b2, d1ad9h1, d1ad9h2, d1ad9l2
    part of humanized Fab CTM01
    complexed with so4

Details for d1ad9a1

PDB Entry: 1ad9 (more details), 2.8 Å

PDB Description: igg-fab fragment of engineered human monoclonal antibody ctm01
PDB Compounds: (A:)

SCOP Domain Sequences for d1ad9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ad9a1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Engineered (including hybrid species)}
diqmtqspstlsasvgdrvtitcrssksllhsngdtflywfqqkpgkapkllmyrmsnla
sgvpsrfsgsgsgteftltisslqpddfatyycmqhleypftfgqgtkvevkr

SCOP Domain Coordinates for d1ad9a1:

Click to download the PDB-style file with coordinates for d1ad9a1.
(The format of our PDB-style files is described here.)

Timeline for d1ad9a1: