SCOPe 2.08: Domain d4fqil2: 4fqi L:108-208

Lineage for d4fqil2 (4fqi L:108-208)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d4fqil2: 4fqi L:108-208 [202123]
   Other proteins in same PDB: d4fqia1, d4fqia2, d4fqib1, d4fqib2, d4fqih_, d4fqil1
   automated match to d2fb4l2
   complexed with edo, gol, nag

Details for d4fqil2

PDB Entry: 4fqi, 1.71 Å

PDB Description: crystal structure of fab cr9114 in complex with a h5n1 influenza virus hemagglutinin

PDB Compounds: (L:) Antibody CR9114 light chain

SCOPe Domain Sequences for d4fqil2:

Sequence; same for both SEQRES and ATOM records:

>d4fqil2 b.1.1.2 (L:108-208) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvap

Timeline for d4fqil2:

• d4fqil2 first appeared in SCOPe 2.03
  
• d4fqil2 appears in SCOPe 2.07