Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers |
Family d.58.4.0: automated matches [191316] (1 protein) not a true family |
Protein automated matches [190081] (27 species) not a true protein |
Species Rhodococcus opacus [TaxId:37919] [196895] (4 PDB entries) |
Domain d4fpir_: 4fpi R: [202109] automated match to d4fpie_ |
PDB Entry: 4fpi (more details), 2.2 Å
SCOPe Domain Sequences for d4fpir_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4fpir_ d.58.4.0 (R:) automated matches {Rhodococcus opacus [TaxId: 37919]} mlylvrmtvnlprnldsreeerlkasekarsrtlqeqgqwrylwrttgkygnisvfdvns hdelheilwslpffpyltidveplshhparvgkd
Timeline for d4fpir_: