Lineage for d1qleh_ (1qle H:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 287097Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)
  6. 287195Protein Immunoglobulin heavy chain variable domain, VH [88543] (19 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogeneous CDRs are listed as engineered species
  7. 287316Species Mouse (Mus musculus), cluster 2.2 [TaxId:10090] [88550] (47 PDB entries)
  8. 287364Domain d1qleh_: 1qle H: [20209]
    Other proteins in same PDB: d1qlea_, d1qleb1, d1qleb2, d1qlec_, d1qled_, d1qlel_
    part of Fv against Paracoccus denitrificans cytochrome c oxidase

Details for d1qleh_

PDB Entry: 1qle (more details), 3 Å

PDB Description: cryo-structure of the paracoccus denitrificans four-subunit cytochrome c oxidase in the completely oxidized state complexed with an antibody fv fragment

SCOP Domain Sequences for d1qleh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qleh_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2}
evklqesggdlvqpggslklscaasgftfssytmswvrqtpekrlewvasinngggrtyy
pdtvkgrftisrdnakntlylqmsslksedtamyycvrheyyyamdywgqgttvtvssa

SCOP Domain Coordinates for d1qleh_:

Click to download the PDB-style file with coordinates for d1qleh_.
(The format of our PDB-style files is described here.)

Timeline for d1qleh_: